Structure of PDB 8t5b Chain C |
>8t5bC (length=56) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
QNFRVYYRDSRDPVWKGPAKLLEKGEGAVVIQDNSDIKVVPRRKAKIIRD YGKQMA |
|
PDB | 8t5b Understanding the resistance of Y99H and A128T mutations in HIV-1 Integrase against the effective anti-HIV drugs of STP0404 and BKC11 |
Chain | C |
Resolution | 2.08 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
QD6 |
C |
W235 K266 |
W15 K46 |
|
|
|