Structure of PDB 8t2n Chain C

Receptor sequence

>8t2nC (length=117) Species: 9606 (Homo sapiens) [Search protein sequence]

MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYL
VPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHE
EDFFLYIAYSDESVYGL

3D structure

PDB

8t2n An LIR motif in the Rift Valley fever virus NSs protein is critical for the interaction with LC3 family members and inhibition of autophagy.

Chain

Resolution

1.88 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	E17 P30 K48 Y49 L50 V51 P52 L55 Q59 L63 F104	E17 P30 K48 Y49 L50 V51 P52 L55 Q59 L63 F104

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0008017	microtubule binding
GO:0008429	phosphatidylethanolamine binding
GO:0031625	ubiquitin protein ligase binding
GO:0048487	beta-tubulin binding
GO:0050811	GABA receptor binding

	Biological Process
GO:0000045	autophagosome assembly
GO:0000226	microtubule cytoskeleton organization
GO:0000422	autophagy of mitochondrion
GO:0006605	protein targeting
GO:0006914	autophagy
GO:0006915	apoptotic process
GO:0006995	cellular response to nitrogen starvation
GO:0007268	chemical synaptic transmission
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors
GO:0015031	protein transport
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0035020	regulation of Rac protein signal transduction
GO:0097352	autophagosome maturation
GO:0098696	regulation of neurotransmitter receptor localization to postsynaptic specialization membrane
GO:1902524	positive regulation of protein K48-linked ubiquitination

	Cellular Component
GO:0000139	Golgi membrane
GO:0000421	autophagosome membrane
GO:0005737	cytoplasm
GO:0005764	lysosome
GO:0005776	autophagosome
GO:0005790	smooth endoplasmic reticulum
GO:0005794	Golgi apparatus
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0005874	microtubule
GO:0005875	microtubule associated complex
GO:0005886	plasma membrane
GO:0005930	axoneme
GO:0012505	endomembrane system
GO:0015629	actin cytoskeleton
GO:0016020	membrane
GO:0031410	cytoplasmic vesicle
GO:0097225	sperm midpiece
GO:0098982	GABA-ergic synapse

External links

PDB	RCSB:8t2n, PDBe:8t2n, PDBj:8t2n
PDBsum	8t2n
PubMed	38512999
UniProt	O95166\|GBRAP_HUMAN Gamma-aminobutyric acid receptor-associated protein (Gene Name=GABARAP)