Structure of PDB 8sza Chain C

Receptor sequence
>8szaC (length=101) Species: 9606 (Homo sapiens) [Search protein sequence]
NHYASKKSAAESMLDIALLMANASQLKAVVEQGPSFAFYVPLVVLISISL
VLQIGVGVLLIFLVKYDLNNPAKHAKLDFLNNLATGLVFIIVVVNIFITA
F
3D structure
PDB8sza How NINJ1 mediates plasma membrane rupture and why NINJ2 cannot
ChainC
Resolution2.75 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 CLR C L97 F100 Y104 L59 F62 Y66
Gene Ontology
Molecular Function
GO:0001530 lipopolysaccharide binding
GO:0005515 protein binding
GO:0098631 cell adhesion mediator activity
GO:0140912 membrane destabilizing activity
Biological Process
GO:0001525 angiogenesis
GO:0002232 leukocyte chemotaxis involved in inflammatory response
GO:0006954 inflammatory response
GO:0007155 cell adhesion
GO:0007399 nervous system development
GO:0019835 cytolysis
GO:0031640 killing of cells of another organism
GO:0034113 heterotypic cell-cell adhesion
GO:0034145 positive regulation of toll-like receptor 4 signaling pathway
GO:0042246 tissue regeneration
GO:0042692 muscle cell differentiation
GO:0045766 positive regulation of angiogenesis
GO:0050729 positive regulation of inflammatory response
GO:0051260 protein homooligomerization
GO:0071474 cellular hyperosmotic response
GO:0097300 programmed necrotic cell death
GO:0097707 ferroptosis
GO:0141201 pyroptotic cell death
Cellular Component
GO:0005576 extracellular region
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0045202 synapse
GO:0097060 synaptic membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8sza, PDBe:8sza, PDBj:8sza
PDBsum8sza
PubMed
UniProtQ92982|NINJ1_HUMAN Ninjurin-1 (Gene Name=NINJ1)

[Back to BioLiP]