Structure of PDB 8syp Chain C

Receptor sequence
>8sypC (length=101) Species: 9606 (Homo sapiens) [Search protein sequence]
AKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAE
ILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNI
Q
3D structure
PDB8syp Structural basis of cooperative targeting of the CX3CR1 nucleosome by PU.1 and C/EBPa
ChainC
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C K15 R17 R20 R32 R77 K4 R6 R9 R21 R66
BS02 dna C K13 R29 R42 V43 G44 A45 T76 R77 K2 R18 R31 V32 G33 A34 T65 R66
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0008150 biological_process
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8syp, PDBe:8syp, PDBj:8syp
PDBsum8syp
PubMed38267599
UniProtQ16777|H2A2C_HUMAN Histone H2A type 2-C (Gene Name=H2AC20)

[Back to BioLiP]