Structure of PDB 8skt Chain C

Receptor sequence

>8sktC (length=337) Species: 10090 (Mus musculus)

DKLKKVLDKLRLKRKDISEAAETVNKVVERLLRRMQSEFKGVEQLNTGSY
YEHVKISAPNEFDVMFKLEVPRIELQEYYETGAFYLVKFPLSHFVLSATK
MLSKFRKIIKEEVKEIKDIDVSVEKEKPGSPAVTLLIRNPEEISVDIILA
LESKGSWPISTKEGLPIQGWLGTKVRTNLRREPFYLVPKQGETWRLSFSH
TEKYILNNHGIEKTCCESSGAKCCRKECLKLMKYLLEQLKKEFQELDAFC
SYHVKTAIFHMWTQDPQDSQWDPRNLSSCFDKLLAFFLECLRTEKLDHYF
IPKFNLFSQELIDRKSKEFLSKKIEYERNNGFPIFDK

3D structure

• PDB: 8skt Structure of ternary complex of mouse cGAS with dsDNA and bound ATP with 5 mM Mn2+
• Chain: C
• Resolution: 2.69 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.86: cyclic GMP-AMP synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	C	T334 K335 T338	T173 K174 T177
BS02	dna	C	R158 L159 K160 R161 H203 K395	R11 L12 K13 R14 H53 K226
BS03	dna	C	R161 S165 A168 Y200	R14 S18 A21 Y50
BS04	ATP	C	G198 S199 E211 D213 R364 S368 E371 K402 S420 Y421 K424	G48 S49 E61 D63 R195 S199 E202 K233 S251 Y252 K255
BS05	ZN	C	H378 C385 C392	H209 C216 C223
BS06	MN	C	E211 D213	E61 D63
BS07	MN	C	E211 D213 D307	E61 D63 D146

External links

• PDB: RCSB:8skt, PDBe:8skt, PDBj:8skt
• PDBsum: 8skt
• PubMed: 38740774
• UniProt: Q8C6L5|CGAS_MOUSE Cyclic GMP-AMP synthase (Gene Name=Cgas)