Structure of PDB 8rjd Chain C

Receptor sequence

>8rjdC (length=362) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

ACARPLISVYSEKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQP
YAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRM
FAPTKTWRRWHRRVNTTQKRYAICSALAASALPALVMSKGHRIEEVPELP
LVVEDKVEGYKKTKEAVLLLKKLKAWNDIKKVYASQRMRAGKGKMRNRRR
IQRRGPCVIYNEDNGIVKAFRNIPGITLLNVTKLNILKLAPGGHVGRFCI
WTESAFRKLDDLYGTWRKAASLKSNYNLPMHKMLNTDLSRILKSPEIQRA
LRAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLRV
ERAAAALAAKSD

3D structure

PDB

8rjd UCSF ChimeraX: Meeting modern challenges in visualization and analysis.

Chain

Resolution

2.78574 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	A2 P6 K29 R33 N38 F39 T42 R45 K46 N47 N48 R49 Q50 Y52 V54 S55 E56 A58 H60 Q61 T62 S63 T69 G70 A72 V73 A74 R75 I76 P77 R80 G82 G83 T84 R86 Q89 G90 N94 M95 C96 R97 G98 R100 M101 F102 A103 P104 K106 W108 R109 R110 R114 N116 T117 T118 Q119 K120 R121 K140 R143 K163 T164 K165 L169 K172 K181 K182 Y184 R188 R190 A191 G192 K193 K195 M196 R197 R199 R204 R205 K219 R222 N223 L235 N236 P242 G243 H245 W267 R268 K274 S275 R291 K294 R303 A304 P305 R306 K307 H310 R311 R312 L314 K316 N317 K320 N321 L322 R323 L326 K327 R336 T339 R342 Q343 N346 H347 R350 R353	A1 P5 K28 R32 N37 F38 T41 R44 K45 N46 N47 R48 Q49 Y51 V53 S54 E55 A57 H59 Q60 T61 S62 T68 G69 A71 V72 A73 R74 I75 P76 R79 G81 G82 T83 R85 Q88 G89 N93 M94 C95 R96 G97 R99 M100 F101 A102 P103 K105 W107 R108 R109 R113 N115 T116 T117 Q118 K119 R120 K139 R142 K162 T163 K164 L168 K171 K180 K181 Y183 R187 R189 A190 G191 K192 K194 M195 R196 R198 R203 R204 K218 R221 N222 L234 N235 P241 G242 H244 W266 R267 K273 S274 R290 K293 R302 A303 P304 R305 K306 H309 R310 R311 L313 K315 N316 K319 N320 L321 R322 L325 K326 R335 T338 R341 Q342 N345 H346 R349 R352
BS02	rna	C	P51 A53 S55 K195 M196	P50 A52 S54 K194 M195

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8rjd, PDBe:8rjd, PDBj:8rjd
PDBsum	8rjd
PubMed	38896445
UniProt	A0A5F9C3C5

[Back to BioLiP]