Structure of PDB 8rdt Chain C |
>8rdtC (length=96) Species: 55518 (Magnetospirillum gryphiswaldense) [Search protein sequence] |
GASIFRCRQCGQTISRRDWLLEHVVFNPFRVWCFSLAQGLRLIGAPSGEF SWFKGYDWTIALCGQCGSHLGWHYEGGSQPQTFFGLIKDRLAEGPA |
|
PDB | 8rdt Discovery and characterization of potent spiro-isoxazole-based cereblon ligands with a novel binding mode. |
Chain | C |
Resolution | 1.95 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
C |
C24 C27 C90 C93 |
C7 C10 C63 C66 |
|
|
|
|