Structure of PDB 8r8r Chain C

Receptor sequence
>8r8rC (length=110) Species: 9606 (Homo sapiens) [Search protein sequence]
ASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMC
PFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGEC
SNKECPFLHI
3D structure
PDB8r8r Molecular basis of human polyA polymerase recruitment by mPSF.
ChainC
Resolution2.79 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna C C68 K69 H70 L75 K77 F84 F98 S106 F112 C63 K64 H65 L70 K72 F79 F93 S101 F107
BS02 ZN C C41 C49 C55 H59 C36 C44 C50 H54
BS03 ZN C C68 C82 H86 C63 C77 H81
BS04 ZN C C96 C105 C110 H114 C91 C100 C105 H109
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
GO:1990837 sequence-specific double-stranded DNA binding
Biological Process
GO:0006397 mRNA processing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005847 mRNA cleavage and polyadenylation specificity factor complex
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8r8r, PDBe:8r8r, PDBj:8r8r
PDBsum8r8r
PubMed38538052
UniProtO95639|CPSF4_HUMAN Cleavage and polyadenylation specificity factor subunit 4 (Gene Name=CPSF4)

[Back to BioLiP]