Structure of PDB 8pw7 Chain C

Receptor sequence

>8pw7C (length=380) Species: 10090 (Mus musculus) [Search protein sequence]

MTNMRKTHPLFKIINHSFIDLPAPSNISSWWNFGSLLGVCLMVQIITGLF
LAMHYTSDTMTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGR
GLYYGSYTFMETWNIGVLLLFAVMATAFMGYVLPWGQMSFWGATVITNLL
SAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFL
HETGSNNPTGLNSDADKIPFHPYYTIKDILGILIMFLILMTLVLFFPDML
GDPDNYMPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALILSILI
LALMPFLHTSKQRSLMFRPITQILYWILVANLLILTWIGGQPVEHPFIII
GQLASISYFSIILILMPISGIIEDKMLKLY

3D structure

PDB

8pw7 SCAF1 drives the compositional diversity of mammalian respirasomes.

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	C	Q44 I45 G48 V66 R80 H83 A84 A87 G130 Y131 L133 H182 F183 P186 F187	Q44 I45 G48 V66 R80 H83 A84 A87 G130 Y131 L133 H182 F183 P186 F187
BS02	HEM	C	W31 G34 L94 H97 V98 R100 S106 W113 G116 L119 H196 L200 N206	W31 G34 L94 H97 V98 R100 S106 W113 G116 L119 H196 L200 N206

Gene Ontology

	Molecular Function
GO:0008121	ubiquinol-cytochrome-c reductase activity
GO:0009055	electron transfer activity
GO:0016491	oxidoreductase activity
GO:0044877	protein-containing complex binding
GO:0046872	metal ion binding

	Biological Process
GO:0001666	response to hypoxia
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c
GO:0007584	response to nutrient
GO:0009410	response to xenobiotic stimulus
GO:0009636	response to toxic substance
GO:0009725	response to hormone
GO:0014070	response to organic cyclic compound
GO:0015990	electron transport coupled proton transport
GO:0022904	respiratory electron transport chain
GO:0031100	animal organ regeneration
GO:0033590	response to cobalamin
GO:0033762	response to glucagon
GO:0045333	cellular respiration
GO:0045471	response to ethanol
GO:0046686	response to cadmium ion
GO:0046688	response to copper ion
GO:0046689	response to mercury ion
GO:0051592	response to calcium ion
GO:0055093	response to hyperoxia

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0016020	membrane
GO:0032991	protein-containing complex
GO:0045275	respiratory chain complex III

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8pw7, PDBe:8pw7, PDBj:8pw7
PDBsum	8pw7
PubMed	38575788
UniProt	P00158\|CYB_MOUSE Cytochrome b (Gene Name=Mt-Cyb)

[Back to BioLiP]