Structure of PDB 8ptz Chain C

Receptor sequence

>8ptzC (length=538) Species: 9606 (Homo sapiens) [Search protein sequence]

SPAELMMLTIGDVIKQLIEAHEQGKDIDLNKVKTKTAAKYGLSAQPRLVD
IIAAVPPQYRKVLMPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNIC
VYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIEQLKQLG
HSVDKVEFIVMGGTFMALPEEYRDYFIRNLHDALSGHTSNNIYEAVKYSE
RSLTKCIGITIETRPDYCMKRHLSDMLTYGCTRLEIGVQSVYEDVARDTN
RGHTVKAVCESFHLAKDSGFKVVAHMMPDLPNVGLERDIEQFTEFFENPA
FRPDGLKLYPTLVIRGTGLYELWKSGRYKSYSPSDLVELVARILALVPPW
TRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGIQCRDVRTREVGIQ
EIHHKVRPYQVELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEE
TFRFELGGGVSIVRELHVYGSVVPVSSRDPTKFQHQGFGMLLMEEAERIA
REEHGSGKIAVISGVGTRNYYRKIGYRLQGPYMVKMLK

3D structure

PDB

8ptz Cryo-EM structure of human Elp123 in complex with tRNA, S-ethyl-CoA, 5'-deoxyadenosine and methionine

Chain

Resolution

3.35 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

2.3.1.311: tRNA carboxymethyluridine synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	C	T43 L51 L57 K79 I81 R82 S85 V89 E131 P132 R136 R151 Q157 L158 M170 R361 Y363 R364 D368 M371 G381 N382 R384 R402	T34 L42 L48 K70 I72 R73 S76 V80 E122 P123 R127 R142 Q148 L149 M161 R352 Y354 R355 D359 M362 G372 N373 R375 R393
BS02	SF4	C	C99 I108 C109 C112 S126 R260	C90 I99 C100 C103 S117 R251
BS03	A2U	C	K164 K214 I216 L475 H476 V477 R487 Q493 H494 G496 M499 G525 T526 Y529 Y530	K155 K205 I207 L466 H467 V468 R478 Q484 H485 G487 M490 G516 T517 Y520 Y521
BS04	MET	C	E221 R223 G246 R260	E212 R214 G237 R251

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003824	catalytic activity
GO:0005515	protein binding
GO:0008607	phosphorylase kinase regulator activity
GO:0016407	acetyltransferase activity
GO:0016746	acyltransferase activity
GO:0016747	acyltransferase activity, transferring groups other than amino-acyl groups
GO:0046872	metal ion binding
GO:0051536	iron-sulfur cluster binding
GO:0051539	4 iron, 4 sulfur cluster binding
GO:0106261	tRNA uridine(34) acetyltransferase activity

	Biological Process
GO:0001764	neuron migration
GO:0002098	tRNA wobble uridine modification
GO:0002926	tRNA wobble base 5-methoxycarbonylmethyl-2-thiouridinylation
GO:0006357	regulation of transcription by RNA polymerase II
GO:0006417	regulation of translation
GO:0007399	nervous system development
GO:0007417	central nervous system development
GO:0008033	tRNA processing
GO:0030335	positive regulation of cell migration

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0033588	elongator holoenzyme complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ptz, PDBe:8ptz, PDBj:8ptz
PDBsum	8ptz
PubMed	38750017
UniProt	Q9H9T3\|ELP3_HUMAN Elongator complex protein 3 (Gene Name=ELP3)

[Back to BioLiP]