Structure of PDB 8ptg Chain C

Receptor sequence

>8ptgC (length=419) Species: 562 (Escherichia coli)

MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIF
GDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGK
IRPPKEGERYFALLKVNEVNFDKPENARNKILFENLTPLHANSRLRMERG
NGSTEDLTARVLDLASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHP
DCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHVQVAEMVIEKA
KRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF
FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIA
EKRVFPAIDYNRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFLI
NKLAMTKTNDDFFEMMKRS

3D structure

• PDB: 8ptg Structure of the transcription termination factor Rho in complex with Rof
• Chain: C
• Resolution: 2.9 Å

Enzymatic activity

• Enzyme Commision number: 3.6.4.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	F64 R66 Y80 S82 R88 R102 E108 Y110 G282 V284 L285 G287	F64 R66 Y80 S82 R88 R102 E108 Y110 G282 V284 L285 G287
BS02	ADP	C	R366 K367	R366 K367
BS03	ADP	C	K181 G183 K184 T185 M186 F355	K181 G183 K184 T185 M186 F355
BS04	BEF	C	P180 K184	P180 K184

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0004386 helicase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0008186 ATP-dependent activity, acting on RNA
• GO:0016787 hydrolase activity
• GO:0016887 ATP hydrolysis activity
• GO:0042802 identical protein binding

Biological Process

• GO:0006353 DNA-templated transcription termination

Cellular Component

• GO:0005829 cytosol
• GO:0016020 membrane

External links

• PDB: RCSB:8ptg, PDBe:8ptg, PDBj:8ptg
• PDBsum: 8ptg
• PubMed: 38622114
• UniProt: P0AG30|RHO_ECOLI Transcription termination factor Rho (Gene Name=rho)