Structure of PDB 8psq Chain C |
>8psqC (length=139) Species: 1549864 (Tilapia lake virus) [Search protein sequence] |
MSQFGKSFKGRTEVTITEYRSHTVKDVHRSLLTADKSLRKSFCFRNALNQ FLDKDLPLLPIRPKLESRVAVKKSKLRSQLSFRPGLTQEEAIDLYNKGYD GDSVSGALQDRVVNEPVAYSSADNDKFHRGLAALGYTLA |
|
PDB | 8psq Structural and functional analysis of the minimal orthomyxovirus-like polymerase of Tilapia Lake Virus from the highly diverged Amnoonviridae family. |
Chain | C |
Resolution | 2.65 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
C |
H28 R29 L31 T33 |
H28 R29 L31 T33 |
|
|
|