Structure of PDB 8phx Chain C |
>8phxC (length=130) Species: 237561 (Candida albicans SC5314) [Search protein sequence] |
PGDISHLRVLVAEDNLVNQEVISRMLKQEGITNLTMACNGAKAIDFVKES IENNENFDLIFMDVQMPEVDGLKATKMIRKNLQYNKPIIALTAFADESNV KECLNSGMSGFITKPISKTNIKKVLVEFLS |
|
PDB | 8phx Structural and functional insights underlying recognition of histidine phosphotransfer protein in fungal phosphorelay systems. |
Chain | C |
Resolution | 1.5 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
C |
D1251 D1300 Q1302 |
D14 D63 Q65 |
|
|
|