Structure of PDB 8ow6 Chain C

Receptor sequence

>8ow6C (length=149) Species: 35672 (Heterocapsa pygmaea) [Search protein sequence]

DKIDDAAKKLSEASYPFLKEIDWSSDVYGKLPTANPFQVLKAVDKMIVMG
AAMDSAALKAGAEAHHKAIGSIDAKGVTTLADYEAVNAAIGHMVASAGES
KTMDVYNAFAGFNLGKDVGPYMMSKVNAADASAAYKAFLEFKDAVKASQ

3D structure

PDB

8ow6 Structural and Spectroscopic Characterization of the Peridinin-Chlorophyll a-Protein (PCP) Complex from Heterocapsa pygmaea (HPPCP)

Chain

Resolution

1.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	C	F17 G61 H65 M93	F17 G61 H65 M93
BS02	PID	C	F17 W23 Y28 G119 M122 M123 A131 Y135	F17 W23 Y28 G119 M122 M123 A131 Y135
BS03	PID	C	V27 Y28 P32 V118 Y121 M122	V27 Y28 P32 V118 Y121 M122
BS04	PID	C	M46 M49 M103 Y106	M46 M49 M103 Y106
BS05	PID	C	W23 A68 I72 G76 V77 T78 Y83 N87 I90 E99 T102 F138 F141 K142 V145	W23 A68 I72 G76 V77 T78 Y83 N87 I90 E99 T102 F138 F141 K142 V145
BS06	W4O	C	M46 Y106 F109 A110 G115 Y135	M46 Y106 F109 A110 G115 Y135
BS07	PID	C	G29 K30	G29 K30
BS08	PID	C	V43 M46	V43 M46

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding

	Cellular Component
GO:0030076	light-harvesting complex

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:8ow6, PDBe:8ow6, PDBj:8ow6
PDBsum	8ow6
PubMed
UniProt	Q9FEY4

[Back to BioLiP]