Structure of PDB 8ou5 Chain C |
>8ou5C (length=87) Species: 55518 (Magnetospirillum gryphiswaldense) [Search protein sequence] |
GASIFRCRQCGQTISRRDWLHVVFNPFRVWCFSLAQGLRLIGAPSGEFSW FYDWTIALCGQCGSHLGWHYEQTFFGLIKDRLAEGPA |
|
PDB | 8ou5 Leveraging Ligand Affinity and Properties: Discovery of Novel Benzamide-Type Cereblon Binders for the Design of PROTACs. |
Chain | C |
Resolution | 2.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
C |
C24 C27 C90 C93 |
C7 C10 C59 C62 |
|
|
|
|