Structure of PDB 8ot8 Chain C

Receptor sequence

>8ot8C (length=405) Species: 2900548 (Actinomycetota bacterium)

STNWAGNVVYRASELHRPASLDELRRVVARSPKVRVLGSGHSFNEITDTE
GALVSLEALPPEVEIDRATGTARVAAGLRYGELSARLHAAGYALPNLASL
PHICVAGACATGTHGSGDGIGGLAGSVTAVELVTADGDLVTLSRDADPDR
FPGAVVSLGALGAVVTMTLRLEPAFQVRQRVYENLPAEALDDHFDEIMAS
GYSVSLFTDWRGDRIRQVWVKERVPVVAALPAPRHPVPGMPAANCTEQLG
VPGPWHERLPHFRLGFTPSGDELQAEYLLPRRHAVAAFHALAGIADRIAP
VLHISEIRTVAADDLWLSPFHGRNTVAFHFTWKPDEAAVREVLSLMEEVL
APFEPRPHWGKLFAIPPKVLRSRYDRIGDFRALARELDPSGKFANAFVAH
HVLDD

3D structure

• PDB: 8ot8 Discovery and biochemical characterization of thermostable glycerol oxidases.
• Chain: C
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	C	W8 R39 V40 G42 S43 G44 H45 S46 F47 I50 T51 A102 S103 L104 I107 C108 A110 G111 T115 T117 H118 L162 G163 V168 Q295 H379 K382	W4 R35 V36 G38 S39 G40 H41 S42 F43 I46 T47 A98 S99 L100 I103 C104 A106 G107 T111 T113 H114 L158 G159 V164 Q274 H358 K361
BS02	XUL	C	S103 F282 Q295 E327 H350 T352 K382	S99 F262 Q274 E306 H329 T331 K361

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Nov 27 17:38:45 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8ot8', asym_id = 'C', title = 'Discovery and biochemical characterization of thermostable glycerol oxidases.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8ot8', asym_id='C', title='Discovery and biochemical characterization of thermostable glycerol oxidases.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003885,0016020,0016899,0050660,0071949', uniprot = '', pdbid = '8ot8', asym_id = 'C'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003885,0016020,0016899,0050660,0071949', uniprot='', pdbid='8ot8', asym_id='C')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>