Structure of PDB 8oq9 Chain C |
>8oq9C (length=100) Species: 9606 (Homo sapiens) [Search protein sequence] |
SGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRW VRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKD |
|
PDB | 8oq9 Structure determination and analysis of titin A-band fibronectin type III domains provides insights for disease-linked variants and protein oligomerisation. |
Chain | C |
Resolution | 1.65 Å |
3D structure |
|
|
Enzyme Commision number |
2.7.11.1: non-specific serine/threonine protein kinase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
C |
H41 E83 |
H39 E81 |
|
|
|