Structure of PDB 8jjt Chain C

Receptor sequence

>8jjtC (length=322) Species: 34073 (Variovorax paradoxus)

SNPSLVIVSPALPGANNGNWRTAQRWKALLSPVCSARVVQQWPDADASAD
TVMLALHARRSAESIAHWAHAHPGRGLGVVLTGTDLYQDIGSDPQAQRSL
QLAQRLVVLQALGAEALPPECRAKARVVYQSTSARAELPKSARQLRAVMV
GHLRQVKSPQTLFDAARLLCGREDIRIDHIGDAGDAGLGELARALASDCP
GYRWLGALPHAQTRQRIQRAHVLVHTSALEGGAHVIMEAVRSGTPVLASR
VPGNVGMLGNDYAGYFPHGDAAALAALLEACRAGQRAAGLLDSLRTQCAL
RAPLFDPRAEQAALFQLLNELQ

3D structure

• PDB: 8jjt Structure of SenB in complex with UDP-GlcNAc at 1.88 Angstroms resolution
• Chain: C
• Resolution: 1.88 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	UD1	C	N17 G19 N20 R22 T23 T83 H153 K158 I181 A208 L209 H211 T214 E231 G232 G233 A234 H235 V236 E239	N16 G18 N19 R21 T22 T82 H152 K157 I180 A207 L208 H210 T213 E230 G231 G232 A233 H234 V235 E238

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Dec 3 04:22:20 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8jjt', asym_id = 'C', title = 'Structure of SenB in complex with UDP-GlcNAc at 1.88 Angstroms resolution'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8jjt', asym_id='C', title='Structure of SenB in complex with UDP-GlcNAc at 1.88 Angstroms resolution')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016757', uniprot = '', pdbid = '8jjt', asym_id = 'C'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016757', uniprot='', pdbid='8jjt', asym_id='C')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>