Structure of PDB 8jfi Chain C

Receptor sequence
>8jfiC (length=236) Species: 210 (Helicobacter pylori) [Search protein sequence]
SMQFTGKNVLITGASKGIGAEIARTLASMGLKVWINYRSNAEVADALKNE
LEEKGYKAAVIKFDAASESDFVEAIQAIVQSDGGLSYLVNNAGVVRDKLA
IKMKTEDFHHVIDNNLTSAFIGCREALKVMSKSRFGSVVNIASIIGERGN
MGQTNYSASKGGMIAMSKSFAYEGALRNIRFNSVTPGFIETDYVKNIPLN
RLGAAKEVAEAVAFLLSDHSSYITGETLKVNGGLYM
3D structure
PDB8jfi The Molecular Basis of Catalysis by SDR Family Members Ketoacyl-ACP Reductase FabG and Enoyl-ACP Reductase FabI in Type-II Fatty Acid Biosynthesis.
ChainC
Resolution2.38 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide C S130 K131 R176 S131 K132 R177
BS02 NAP C G12 K15 G16 I17 R37 S38 D63 A64 N90 A91 G92 V93 Y155 K159 P185 I188 T190 G13 K16 G17 I18 R38 S39 D64 A65 N91 A92 G93 V94 Y156 K160 P186 I189 T191
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Nov 25 11:07:51 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8jfi', asym_id = 'C', title = 'The Molecular Basis of Catalysis by SDR Family M...ductase FabI in Type-II Fatty Acid Biosynthesis. '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8jfi', asym_id='C', title='The Molecular Basis of Catalysis by SDR Family M...ductase FabI in Type-II Fatty Acid Biosynthesis. ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0004316,0006633,0016491,0051287', uniprot = '', pdbid = '8jfi', asym_id = 'C'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004316,0006633,0016491,0051287', uniprot='', pdbid='8jfi', asym_id='C')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>