Structure of PDB 8j6z Chain C

Receptor sequence
>8j6zC (length=80) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
SHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGC
KRCESACPTDFLSVRVYLWHETTRSMGLAY
3D structure
PDB8j6z Cryo-EM structure of the Arabidopsis thaliana photosystem I(PSI-LHCII-ST2)
ChainC
Resolution2.79 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.97.1.12: photosystem I.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 C C21 P22 V25 C48 V49 G50 C51 K52 C54 V67 C20 P21 V24 C47 V48 G49 C50 K51 C53 V66
BS02 SF4 C C11 I12 G13 C14 C17 C58 P59 V65 C10 I11 G12 C13 C16 C57 P58 V64
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0009055 electron transfer activity
GO:0016491 oxidoreductase activity
GO:0046872 metal ion binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0009773 photosynthetic electron transport in photosystem I
GO:0015979 photosynthesis
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009533 chloroplast stromal thylakoid
GO:0009534 chloroplast thylakoid
GO:0009535 chloroplast thylakoid membrane
GO:0009536 plastid
GO:0009579 thylakoid
GO:0016020 membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8j6z, PDBe:8j6z, PDBj:8j6z
PDBsum8j6z
PubMed37936349
UniProtP62090|PSAC_ARATH Photosystem I iron-sulfur center (Gene Name=psaC)

[Back to BioLiP]