Structure of PDB 8iy0 Chain C |
>8iy0C (length=91) Species: 270673 (Pseudomonas phage PaP2) [Search protein sequence] |
NQHKKIKGYRDLSQEEIDMMNRVKELGSQFEKLIQDVSDHLRGQYNASLH NRDEITRIANAEPGRWLAIGKTDIQTGMMAIIRAIAQPDSF |
|
PDB | 8iy0 Phage anti-CBASS protein simultaneously sequesters cyclic trinucleotides and dinucleotides. |
Chain | C |
Resolution | 2.26 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
3AM |
C |
A70 T74 |
A68 T72 |
|
|
|