Structure of PDB 8iug Chain C

Receptor sequence

>8iugC (length=316) Species: 120962 (Roseiflexus castenholzii)

PPTLFPEITNTVRGRFYIVAGIISVVMAVASIAIFWWIFYTITPAPAPPL
QNPIYVNYTQEPTDYISAESLAAMNAYIQANPQPQAVQVLKGMTTAQISA
YMVAQVSGGLKVDCSYCHNIANFAQQDGYPNAAKKVTARKMMLMSADLNQ
NYTAKLPASVGGYQITCATCHNGKAAGLEPYPIEIMNTLPNDWRLPLELD
YPGGLVVTGRKDVSNHEVEQNQFAMYHMNVSMGQGCTFCHNARYFPSYEI
AQKNHSIIMLQMTKHIQETYVAPGGRIADGIMAGKSPSCWLCHQGANIPP
GAAKPGQVPAVLSSTP

3D structure

• PDB: 8iug New insights on the photocomplex of Roseiflexus castenholzii revealed from comparisons of native and carotenoid-depleted complexes.
• Chain: C
• Resolution: 2.86 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	C	I38 W41	I34 W37
BS02	HEC	C	M78 Q89 A90 Q92 V93 I102 M106 V110 C118 C121 H122 K139 R143	M74 Q85 A86 Q88 V89 I98 M102 V106 C114 C117 H118 K135 R139
BS03	HEC	C	M145 M146 C171 C174 H175 L182 M286	M141 M142 C167 C170 H171 L178 M282
BS04	HEC	C	G207 L209 T212 Q226 M229 C240 C243 H244 F249 P250 K257 S260	G203 L205 T208 Q222 M225 C236 C239 H240 F245 P246 K253 S256
BS05	HEC	C	V164 I169 M232 M236 Q256 M263 M266 C293 C296 H297 N301 P303	V160 I165 M228 M232 Q252 M259 M262 C289 C292 H293 N297 P299
BS06	CA	C	M190 N191 L193 N195	M186 N187 L189 N191

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding

Biological Process

• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex

External links

• PDB: RCSB:8iug, PDBe:8iug, PDBj:8iug
• PDBsum: 8iug
• PubMed: 37468106
• UniProt: Q83XC9