Structure of PDB 8ir1 Chain C

Receptor sequence

>8ir1C (length=248) Species: 9606 (Homo sapiens) [Search protein sequence]

GFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRM
IVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCT
GLLLARRLLNRFGMDKGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSI
PHSTKRFPGYDSESKEFNAEVHRKHIMGQNVADYMRYLMEEDEDAYKKQF
SQYIKNSVTPDMMEEMYKKAHAAIRENPVYEKKPKKEVKKKRWNRPKM

3D structure

PDB

8ir1 Visualizing the nucleoplasmic maturation of human pre-60S ribosomal particles.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	V4 Y12 R15 Y16 Q17 R23 G26 D29 R35 D40 K48 Y145 L150 R152 T153 H175 S176 K178 R179	V3 Y11 R14 Y15 Q16 R22 G25 D28 R34 D39 K47 Y122 L127 R129 T130 H152 S153 K155 R156
BS02	rna	C	K10 F13 K14 Y16 V18 R21 R22 R24 K27 T28 Y30 R33 T56 N57 R58 E70 D72 M73 I74 Y79 L92 N94 T155 G156 N157 K158 Q225 K258 E260 K262 K263 W266 R268 K270	K9 F12 K13 Y15 V17 R20 R21 R23 K26 T27 Y29 R32 T55 N56 R57 E69 D71 M72 I73 Y78 L91 N93 T132 G133 N134 K135 Q202 K235 E237 K239 K240 W243 R245 K247

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003730	mRNA 3'-UTR binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding
GO:0031625	ubiquitin protein ligase binding
GO:0048027	mRNA 5'-UTR binding
GO:1990948	ubiquitin ligase inhibitor activity

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0006412	translation
GO:0010628	positive regulation of gene expression
GO:0042273	ribosomal large subunit biogenesis
GO:0045727	positive regulation of translation
GO:0050821	protein stabilization
GO:1901796	regulation of signal transduction by p53 class mediator
GO:1904667	negative regulation of ubiquitin protein ligase activity
GO:2000059	negative regulation of ubiquitin-dependent protein catabolic process
GO:2000435	negative regulation of protein neddylation

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005829	cytosol
GO:0005840	ribosome
GO:0005925	focal adhesion
GO:0016020	membrane
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:0032991	protein-containing complex
GO:0070062	extracellular exosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ir1, PDBe:8ir1, PDBj:8ir1
PDBsum	8ir1
PubMed	37491604
UniProt	P46777\|RL5_HUMAN Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]