Structure of PDB 8ik5 Chain C

Receptor sequence
>8ik5C (length=67) Species: 9606 (Homo sapiens) [Search protein sequence]
HMHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVV
QVWFQNQRAKMKKLARR
3D structure
PDB8ik5 Structural insights into the recognition of the A/T-rich motif in target gene promoters by the LMX1a homeobox domain
ChainC
Resolution1.989 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C K196 R199 K219 R222 Q244 R247 K7 R10 K30 R33 Q55 R58
BS02 dna C R199 T200 V241 N245 K249 R10 T11 V52 N56 K60
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8ik5, PDBe:8ik5, PDBj:8ik5
PDBsum8ik5
PubMed
UniProtQ8TE12|LMX1A_HUMAN LIM homeobox transcription factor 1-alpha (Gene Name=LMX1A)

[Back to BioLiP]