Structure of PDB 8ijr Chain C

Receptor sequence

>8ijrC (length=264) Species: 9606 (Homo sapiens)

RLDPEYWKTILSCIYVFIVFGFTSFIMVIVHERVPDMQTYPPLPDIFLDS
VPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILLRRLCSLMGTVFLLR
CFTMFVTSLSVPGQHLQCTGKIYGSVWEKLHRAFAIWSGFGMTLTGVHTC
GDYMFSGHTVVLTMLNFFVTEYTPRSWNFLHTLSWVLNLFGIFFILAAHE
HYSIDVFIAFYITTRLFLYYHTLANTRAYQQSRRARIWFPMFSFFECNVN
GTVPNEYCWPFSKP

3D structure

• PDB: 8ijr Cryo-EM structure of human sphingomyelin synthase and its mechanistic implications for sphingomyelin synthesis.
• Chain: C
• Resolution: 3.29 Å

Enzymatic activity

• Enzyme Commision number: 2.7.8.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	Z0P	C	F163 M170 C212 R243 F283 D295 H301	F20 M27 C69 R100 F140 D152 H158

Gene Ontology

Molecular Function

• GO:0002950 ceramide phosphoethanolamine synthase activity
• GO:0003674 molecular_function
• GO:0016740 transferase activity
• GO:0016780 phosphotransferase activity, for other substituted phosphate groups
• GO:0033188 sphingomyelin synthase activity
• GO:0047493 ceramide cholinephosphotransferase activity

Biological Process

• GO:0006665 sphingolipid metabolic process
• GO:0006686 sphingomyelin biosynthetic process
• GO:0046513 ceramide biosynthetic process
• GO:1905373 ceramide phosphoethanolamine biosynthetic process
• GO:2000303 regulation of ceramide biosynthetic process

Cellular Component

• GO:0000139 Golgi membrane
• GO:0005783 endoplasmic reticulum
• GO:0005789 endoplasmic reticulum membrane
• GO:0005829 cytosol
• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:8ijr, PDBe:8ijr, PDBj:8ijr
• PDBsum: 8ijr
• PubMed: 38388831
• UniProt: Q96LT4|SAMD8_HUMAN Sphingomyelin synthase-related protein 1 (Gene Name=SAMD8)