Structure of PDB 8ihm Chain C

Receptor sequence
>8ihmC (length=107) Species: 8355 (Xenopus laevis) [Search protein sequence]
AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAE
ILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNI
QSVLLPK
3D structure
PDB8ihm Structural basis for nucleosome binding and catalysis by the yeast Rpd3S/HDAC holoenzyme.
ChainC
Resolution3.58 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C K15 R17 R32 R77 K4 R6 R21 R66
BS02 dna C K13 R42 V43 G44 A45 K75 T76 R77 K2 R31 V32 G33 A34 K64 T65 R66
BS03 peptide C A60 A69 D72 N73 R81 N89 D90 E91 E92 P109 A49 A58 D61 N62 R70 N78 D79 E80 E81 P98
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8ihm, PDBe:8ihm, PDBj:8ihm
PDBsum8ihm
PubMed37845487
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]