Structure of PDB 8i8o Chain C

Receptor sequence

>8i8oC (length=159)

MSTKAIYPGTFDPITNGHIDIITRAASMFDRVILAIAASPSKKPMFDLEE
RVALATTALQHLPNVEVMGFSDLMANFARAQQANILIRGLRAVADFEYEM
QLAHMNRHLMPELESVFLMPSKEWSFISSSLVKEVARHAGDVTHFLPANV
HQALMEKLK

3D structure

• PDB: 8i8o Crystal structure of the ternary complex of Phosphopantetheine adenylyltransferase (PPAT) from Enterobacter sp. with Dephosphocoenzyme-A and Phosphonoacetic acid at 2.41 A resolution.
• Chain: C
• Resolution: Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PAE	C	H18 S128 S129	H18 S128 S129

External links

• PDB: RCSB:8i8o, PDBe:8i8o, PDBj:8i8o
• PDBsum: 8i8o