Structure of PDB 8hrs Chain C

Receptor sequence

>8hrsC (length=334) Species: 196627 (Corynebacterium glutamicum ATCC 13032)

TIRVGINGFGRIGRNFFRAVLERSDDLEVVAVNDSKDNKTLSTLLKFDSI
MGRLGQEVEYDDDSITVGGKRIAVYAERDPKNLDWAAHNVDIVIESTGFF
TDANAAKAHIEAGAKKVIISAPASNEDATFVYGVNHESYDPENHNVISGA
SCTTNCLAPMAKVLNDKFGIENGLMTTVHAYTGDQRLHDASHRDLRRARA
AAVNIVPTSTGAAKAVALVLPELKGKLDGYALRVPVITGSATDLTFNTKS
EVTVESINAAIKEAAVGEFGETLAYSEEPLVSTDIVHDSHGSIFDAGLTK
VSGNTVKVVSWYDNEWGYTCQLLRLTELVASKLL

3D structure

• PDB: 8hrs Structure-Guided Protein Engineering of Glyceraldehyde-3-phosphate Dehydrogenase from Corynebacterium glutamicum for Dual NAD/NADP Cofactor Specificity.
• Chain: C
• Resolution: 2.0 Å

Enzymatic activity

• Enzyme Commision number: 1.2.1.12: glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	C	F10 G11 R12 I13 D35 S36 K37 R79 S97 T98 G99 S121 C153 N315 Y319	F9 G10 R11 I12 D34 S35 K36 R78 S96 T97 G98 S120 C152 N314 Y318

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004365 glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity
• GO:0016491 oxidoreductase activity
• GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
• GO:0050661 NADP binding
• GO:0051287 NAD binding

Biological Process

• GO:0006006 glucose metabolic process
• GO:0006096 glycolytic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:8hrs, PDBe:8hrs, PDBj:8hrs
• PDBsum: 8hrs
• PubMed: 37935620
• UniProt: Q01651|G3P_CORGL Glyceraldehyde-3-phosphate dehydrogenase (Gene Name=gap)