Structure of PDB 8hfp Chain C |
>8hfpC (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] |
LSYQSHDCSGACLGENPLQLPIKCHFQRRHAKTNSHSSALHVSYKTPCGR SLRNVEEVFRYLLETECNFLFTDNFSFNTYVQLARNY |
|
PDB | 8hfp Structural Evidence for Protein Binding by the Methyl-CpG-Binding Domain of SETDB Proteins |
Chain | C |
Resolution | 1.82 Å |
3D structure |
|
|
Enzyme Commision number |
2.1.1.366: [histone H3]-N(6),N(6)-dimethyl-lysine(9) N-methyltransferase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
C |
H14 C16 C20 C64 |
H6 C8 C12 C48 |
|
|
|
|