Structure of PDB 8gs8 Chain C

Receptor sequence
>8gs8C (length=136) Species: 9606 (Homo sapiens) [Search protein sequence]
AKEEMERFWNKNIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALSAGVS
LFGMSALLLPGNFESYLELVKSLCLGPALIHTAKFALVFPLMYHTWNGIR
HLMWDLGKGLKIPQLYQSGVVVLVLTVLSSMGLAAM
3D structure
PDB8gs8 Structure of the human respiratory complex II.
ChainC
Resolution2.86 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 UQ1 C I56 W61 M65 I69 I23 W28 M32 I36
BS02 HEM C H71 R72 G75 L78 S79 H127 T128 H38 R39 G42 L45 S46 H94 T95
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0006099 tricarboxylic acid cycle
GO:0006121 mitochondrial electron transport, succinate to ubiquinone
GO:0009060 aerobic respiration
GO:0042776 proton motive force-driven mitochondrial ATP synthesis
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0016020 membrane
GO:0045273 respiratory chain complex II (succinate dehydrogenase)

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8gs8, PDBe:8gs8, PDBj:8gs8
PDBsum8gs8
PubMed37098072
UniProtQ99643|C560_HUMAN Succinate dehydrogenase cytochrome b560 subunit, mitochondrial (Gene Name=SDHC)

[Back to BioLiP]