Structure of PDB 8git Chain C

Receptor sequence

>8gitC (length=348) Species: 10090 (Mus musculus)

DKLKKVLDKLRLKRKDISEAAETVNKVVERLLRRMQKRESEFKGVEQLNT
GSYYEHVKISAPNEFDVMFKLEVPRIELQEYYETGAFYLVKFPLSHFVLS
ATKMLSKFRKIIKEEVKEIKDIDVSVEKEKPGSPAVTLLIRNPEEISVDI
ILALESKGSWPISTKEGLPIQGWLGTKVRTNLRREPFYLVPKNAKDGNSF
QGETWRLSFSHTEKYILNNHGIEKTCCESSGAKCCRKECLKLMKYLLEQL
KKEFQELDAFCSYHVKTAIFHMWTQDPQDSQWDPRNLSSCFDKLLAFFLE
CLRTEKLDHYFIPKFNLFSQELIDRKSKEFLSKKIEYERNNGFPIFDK

3D structure

• PDB: 8git Structure of Ternary Complex of mouse cGAS with dsDNA and Bound ATP: with 10mM Mg2+ and 1mM Mn2+
• Chain: C
• Resolution: 2.72 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.86: cyclic GMP-AMP synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	C	T334 K335 T338	T176 K177 T180
BS02	dna	C	R222 K315	R75 K157
BS03	dna	C	R158 L159 K160 R161 K395	R11 L12 K13 R14 K237
BS04	dna	C	R161 S165 A168 Y200 K372	R14 S18 A21 Y53 K214
BS05	ATP	C	G198 S199 E211 D213 R364 S368 E371 K402 S420 Y421	G51 S52 E64 D66 R206 S210 E213 K244 S262 Y263
BS06	ZN	C	H378 C385 C392	H220 C227 C234
BS07	MN	C	E211 D213 D307	E64 D66 D149
BS08	MN	C	S199 E211 D213	S52 E64 D66

External links

• PDB: RCSB:8git, PDBe:8git, PDBj:8git
• PDBsum: 8git
• PubMed: 38740774
• UniProt: Q8C6L5|CGAS_MOUSE Cyclic GMP-AMP synthase (Gene Name=Cgas)