Structure of PDB 8gbj Chain C

Receptor sequence
>8gbjC (length=317) Species: 9606 (Homo sapiens) [Search protein sequence]
EMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEAL
ETLQIIRREKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEI
CGAPGVGKTQLCMQLAVDVQIPECFGGVAGEAVFIDTEGSFMVDRVVDLA
TACIQHLQLIAEKHKGEEHRKALEDFTLDNILSHIYYFRCRDYTELLAQV
YLLPDFLSEHSKVRLVIVDGIAFPFRHDLDDLSLRTRLLNGLAQQMISLA
NNHRLAVILTNQMTTLVPALGESWGHAATIRLIFHWDRKQRLATLYKSPS
QKECTVLFQIKPQGFRD
3D structure
PDB8gbj Structural insights into BCDX2 complex function in homologous recombination.
ChainC
Resolution3.11 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C S256 E303 S233 E272
BS02 ANP C P127 G128 G130 K131 T132 Q133 E161 R168 I341 P104 G105 G107 K108 T109 Q110 E138 R145 I310
BS03 ANP C K328 P330 Q332 K333 K297 P299 Q301 K302
Gene Ontology
Molecular Function
GO:0000400 four-way junction DNA binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008821 crossover junction DNA endonuclease activity
GO:0140664 ATP-dependent DNA damage sensor activity
Biological Process
GO:0000707 meiotic DNA recombinase assembly
GO:0000722 telomere maintenance via recombination
GO:0000724 double-strand break repair via homologous recombination
GO:0006259 DNA metabolic process
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0007062 sister chromatid cohesion
GO:0007066 female meiosis sister chromatid cohesion
GO:0007131 reciprocal meiotic recombination
GO:0007141 male meiosis I
GO:0007283 spermatogenesis
GO:0010971 positive regulation of G2/M transition of mitotic cell cycle
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005657 replication fork
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0030054 cell junction
GO:0033063 Rad51B-Rad51C-Rad51D-XRCC2 complex
GO:0033065 Rad51C-XRCC3 complex
GO:0043231 intracellular membrane-bounded organelle
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8gbj, PDBe:8gbj, PDBj:8gbj
PDBsum8gbj
PubMed37344589
UniProtO43502|RA51C_HUMAN DNA repair protein RAD51 homolog 3 (Gene Name=RAD51C)

[Back to BioLiP]