Structure of PDB 8g7t Chain C

Receptor sequence
>8g7tC (length=616) Species: 9606 (Homo sapiens) [Search protein sequence]
FKPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQK
GKVVFFANQIPVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVEN
NDIIILTPQILVNNLKKGTIPSLSIFTLMIFDECHNTSKQHPYNMIMFNY
LDQKLGGSSGPLPQVIGLTASVGVGDAKNTDEALDYICKLCASLDASVIA
TVKHNLEELEQVVYKPQKFFRKVESRISDKFKYIIAQLMRDTESLAKRIC
KDLENLSQIQNREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFL
YTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRF
EEKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALV
DALKNWIEGNPKLSFLKPHNILIATSVNLVILYEYVSKCFLLTSNAGVIE
KEQINMYKEKMMNDSILRLQTWDEAVFREKILHIQTHEKFIRDSVPDKEN
KKLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPKQFSS
FEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLY
SKWKDFHFEKIPFDPA
3D structure
PDB8g7t Cryo-EM structure of Riplet:RIG-I:dsRNA complex (end-inter)
ChainC
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.4.13: RNA helicase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna C Q299 I300 G326 Q349 K418 R546 R637 F853 S854 Q59 I60 G86 Q109 K178 R306 R397 F548 S549
BS02 rna C K379 Q380 I499 Q507 K508 K750 C829 H830 H847 F853 K888 W908 K139 Q140 I259 Q267 K268 K451 C524 H525 H542 F548 K583 W603
BS03 ZN C C813 C864 C508 C559
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003690 double-stranded DNA binding
GO:0003723 RNA binding
GO:0003724 RNA helicase activity
GO:0003725 double-stranded RNA binding
GO:0003727 single-stranded RNA binding
GO:0004386 helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0005525 GTP binding
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0031625 ubiquitin protein ligase binding
GO:0038187 pattern recognition receptor activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0002230 positive regulation of defense response to virus by host
GO:0002376 immune system process
GO:0002735 positive regulation of myeloid dendritic cell cytokine production
GO:0002753 cytoplasmic pattern recognition receptor signaling pathway
GO:0009597 detection of virus
GO:0009615 response to virus
GO:0010467 gene expression
GO:0010628 positive regulation of gene expression
GO:0030334 regulation of cell migration
GO:0032725 positive regulation of granulocyte macrophage colony-stimulating factor production
GO:0032727 positive regulation of interferon-alpha production
GO:0032728 positive regulation of interferon-beta production
GO:0032755 positive regulation of interleukin-6 production
GO:0032757 positive regulation of interleukin-8 production
GO:0032760 positive regulation of tumor necrosis factor production
GO:0034344 regulation of type III interferon production
GO:0039529 RIG-I signaling pathway
GO:0043330 response to exogenous dsRNA
GO:0045087 innate immune response
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051607 defense response to virus
GO:0060760 positive regulation of response to cytokine stimulus
GO:0071360 cellular response to exogenous dsRNA
GO:0140374 antiviral innate immune response
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0005923 bicellular tight junction
GO:0015629 actin cytoskeleton
GO:0032587 ruffle membrane
GO:0042995 cell projection
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8g7t, PDBe:8g7t, PDBj:8g7t
PDBsum8g7t
PubMed37951994
UniProtO95786|RIGI_HUMAN Antiviral innate immune response receptor RIG-I (Gene Name=RIGI)

[Back to BioLiP]