Structure of PDB 8g6w Chain C

Receptor sequence
>8g6wC (length=206) Species: 562 (Escherichia coli) [Search protein sequence]
GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKAS
VSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQI
NIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKV
EVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVW
IFKGEI
3D structure
PDB8g6w Structure of WT E.coli 70S ribosome subunit with complexed with mRNA, P-site fMet-NH-tRNAfMet and A-site ortho-aminobenzoic acid charged NH-tRNAPhe
ChainC
Resolution2.02 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna C G2 Q3 K4 V5 G155 R156 E161 A163 R169 G171 R172 L175 H176 T177 L178 R179 T192 G194 V195 G197 K199 G1 Q2 K3 V4 G154 R155 E160 A162 R168 G170 R171 L174 H175 T176 L177 R178 T191 G193 V194 G196 K198
BS02 rna C I162 R164 I161 R163
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8g6w, PDBe:8g6w, PDBj:8g6w
PDBsum8g6w
PubMed37396857
UniProtP0A7V3|RS3_ECOLI Small ribosomal subunit protein uS3 (Gene Name=rpsC)

[Back to BioLiP]