Structure of PDB 8f15 Chain C

Receptor sequence

>8f15C (length=134) Species: 9606 (Homo sapiens)

GASPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCY
LKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRA
YSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERR

3D structure

• PDB: 8f15 Single-Shot Flow Synthesis of D-Proteins for Mirror-Image Phage Display
• Chain: C
• Resolution: 1.73 Å

Enzymatic activity

• Enzyme Commision number: 2.3.2.27: RING-type E3 ubiquitin transferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	K30 N34 V61 K95 F98 Q102 F131 D134 S137 A138 I141	K10 N14 V41 K75 F78 Q82 F111 D114 S117 A118 I121
BS02	WHL	C	N34 F37 V38 K72	N14 F17 V18 K52

External links

• PDB: RCSB:8f15, PDBe:8f15, PDBj:8f15
• PDBsum: 8f15
• UniProt: Q9UNE7|CHIP_HUMAN E3 ubiquitin-protein ligase CHIP (Gene Name=STUB1)