Structure of PDB 8evz Chain C

Receptor sequence

>8evzC (length=315) Species: 208964 (Pseudomonas aeruginosa PAO1)

NLCLDSLLNGTQDPKAFGRVAVLFGGKSAEREVSLKSGAMVLQSLLAAGV
DAFGIDVGEDLLQRLVEEKIDRAFIILHGRGGEDGSMQGLLECAGIPYTG
SGVLASALAMDKLRTKRVWLSLGLPTPDYAVLASEDDCREAAQRLGFPLI
VKPAHEGSSIGMAKVGGLDELIAAWREAARYDSQVLVEQWISGPEFTVAT
LRGQVLPAIRLGTPHTFYDYDAKYLASDTRYQVPCGLDEAKERELKELTA
RACDALGIQGWGRADVMQDAEGRFWLLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILADSRE

3D structure

• PDB: 8evz Comparative functional and structural analysis of Pseudomonas aeruginosa d-alanine-d-alanine ligase isoforms as prospective antibiotic targets.
• Chain: C
• Resolution: 2.45 Å

Enzymatic activity

• Enzyme Commision number: 6.3.2.4: D-alanine--D-alanine ligase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	C	E279 N281	E278 N280
BS02	MG	C	D266 E279	D265 E278
BS03	ADP	C	K113 I151 K153 G158 S160 M163 E189 W191 I192 E196 Y219 L278 E279	K112 I150 K152 G157 S159 M162 E188 W190 I191 E195 Y218 L277 E278
BS04	DS0	C	E31 S159 K224 R264 E279 N281 G285	E30 S158 K223 R263 E278 N280 G284

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0005524 ATP binding
• GO:0008716 D-alanine-D-alanine ligase activity
• GO:0016874 ligase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0008360 regulation of cell shape
• GO:0009252 peptidoglycan biosynthetic process
• GO:0071555 cell wall organization

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:8evz, PDBe:8evz, PDBj:8evz
• PDBsum: 8evz
• PubMed: 37581574
• UniProt: Q9LCT6|DDLB_PSEAE D-alanine--D-alanine ligase B (Gene Name=ddlB)