Structure of PDB 8evy Chain C

Receptor sequence

>8evyC (length=314) Species: 208964 (Pseudomonas aeruginosa PAO1)

LCLDSLLNGTQDPKAFGRVAVLFGGKSAEREVSLKSGAMVLQSLLAAGVD
AFGIDVGEDLLQRLVEEKIDRAFIILHGRGGEDGSMQGLLECAGIPYTGS
GVLASALAMDKLRTKRVWLSLGLPTPDYAVLASEDDCREAAQRLGFPLIV
KPAHEGSSIGMAKVGGLDELIAAWREAARYDSQVLVEQWISGPEFTVATL
RGQVLPAIRLGTPHTFYDYDAKYLASDTRYQVPCGLDEAKERELKELTAR
ACDALGIQGWGRADVMQDAEGRFWLLEVNTAPGMTDHSLVPMAARAAGLD
FQQLVLAILADSRE

3D structure

• PDB: 8evy Comparative functional and structural analysis of Pseudomonas aeruginosa d-alanine-d-alanine ligase isoforms as prospective antibiotic targets.
• Chain: C
• Resolution: 2.35 Å

Enzymatic activity

• Enzyme Commision number: 6.3.2.4: D-alanine--D-alanine ligase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	DAL	C	E31 H79 Y225 R264 G285	E29 H77 Y223 R262 G283
BS02	DAL	C	K224 Y225 R264 S290 L291	K222 Y223 R262 S288 L289
BS03	MG	C	E279 N281	E277 N279
BS04	MG	C	D266 E279	D264 E277
BS05	ATP	C	K113 I151 K153 G158 S159 S160 M163 E189 W191 I192 E196 Y219 K224 D266 L278 E279 N281	K111 I149 K151 G156 S157 S158 M161 E187 W189 I190 E194 Y217 K222 D264 L276 E277 N279

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0005524 ATP binding
• GO:0008716 D-alanine-D-alanine ligase activity
• GO:0016874 ligase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0008360 regulation of cell shape
• GO:0009252 peptidoglycan biosynthetic process
• GO:0071555 cell wall organization

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:8evy, PDBe:8evy, PDBj:8evy
• PDBsum: 8evy
• PubMed: 37581574
• UniProt: Q9LCT6|DDLB_PSEAE D-alanine--D-alanine ligase B (Gene Name=ddlB)