Structure of PDB 8ev3 Chain C

Receptor sequence

>8ev3C (length=362) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]

AAARPTVSIYNKDGSVSSETLALPFVFKAPIRPDLVRSVHTAVAKNKRQP
YAVSEKAGHQTSAESWGTGRALARIPRVGGGGTHRSGQAAFGNMCRSGRM
FAPTKTWRKWHVKVNQNEKRYAIASAVAASGVPSLLLARGHRIEEIPEVP
LVVDDAVQSFQKTKEAVALLKEIKAYRDVIKVANSRKLRAGKGKLRNRRH
VQRRGPLVVFNEDTGIVKAFRNIPGVEIVNVRRLNLLQLAPGGHLGRFVI
WTKSAFGLLDSVFGSTTEVAQLKKNYFLPENIISNADVTRLINSDEIQSI
VKAAGPSRVKRAHVQKKNPLKNKAVLSRLNPYAKAYKANVKINSEKTPKA
AGEKFLSVLHEN

3D structure

PDB

8ev3 Chromatin localization of nucleophosmin organizes ribosome biogenesis.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	R33 L36 R38 T42 A45 K46 N47 K48 R49 Q50 Y52 V54 S55 A58 Q61 T62 S63 G70 A72 L73 R75 I76 P77 G82 G83 T84 R86 Q89 N94 M95 C96 R97 S98 R100 M101 F102 A103 P104 K106 W108 R109 K110 K114 N116 Q117 N118 E119 K120 R121 Y122 R140 R143 K163 T164 K188 L189 R190 A191 G192 K193 K195 L196 R197 N198 R199 R204 R205 V218 K219 R222 N223 I229 R234 L235 N236 P242 G243 H245 K274 K275 I293 N294 D296 Q299 A305 G306 P307 R309 V310 K311 R312 H314 V315 Q316 K318 K322 N323 S328 R329 A334 Y337 A339 N340 N344 E346 T348 P349 K350 A351 A352 F356 L360	R32 L35 R37 T41 A44 K45 N46 K47 R48 Q49 Y51 V53 S54 A57 Q60 T61 S62 G69 A71 L72 R74 I75 P76 G81 G82 T83 R85 Q88 N93 M94 C95 R96 S97 R99 M100 F101 A102 P103 K105 W107 R108 K109 K113 N115 Q116 N117 E118 K119 R120 Y121 R139 R142 K162 T163 K187 L188 R189 A190 G191 K192 K194 L195 R196 N197 R198 R203 R204 V217 K218 R221 N222 I228 R233 L234 N235 P241 G242 H244 K273 K274 I292 N293 D295 Q298 A304 G305 P306 R308 V309 K310 R311 H313 V314 Q315 K317 K321 N322 S327 R328 A333 Y336 A338 N339 N343 E345 T347 P348 K349 A350 A351 F355 L359
BS02	rna	C	P51 A53 S55 T107 K195	P50 A52 S54 T106 K194

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ev3, PDBe:8ev3, PDBj:8ev3
PDBsum	8ev3
PubMed	36423630
UniProt	Q9P784\|RL4B_SCHPO Large ribosomal subunit protein uL4B (Gene Name=rpl401)

[Back to BioLiP]