Structure of PDB 8etc Chain C

Receptor sequence

>8etcC (length=359) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]

RPTVSIYNKDGSVSSETLALPFVFKAPIRPDLVRSVHTAVAKNKRQPYAV
SEKAGHQTSAESWGTGRALARIPRVGGGGTHRSGQAAFGNMCRSGRMFAP
TKTWRKWHVKVNQNEKRYAIASAVAASGVPSLLLARGHRIEEIPEVPLVV
DDAVQSFQKTKEAVALLKEIKAYRDVIKVANSRKLRAGKGKLRNRRHVQR
RGPLVVFNEDTGIVKAFRNIPGVEIVNVRRLNLLQLAPGGHLGRFVIWTK
SAFGLLDSVFGSTTEVAQLKKNYFLPENIISNADVTRLINSDEIQSIVKA
AGPSRVKRAHVQKKNPLKNKAVLSRLNPYAKAYKANVKINSEKTPKAAGE
KFLSVLHEN

3D structure

PDB

8etc Chromatin localization of nucleophosmin organizes ribosome biogenesis.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	C	R33 L36 R38 T42 K46 N47 K48 R49 Q50 Y52 V54 S55 E56 A58 H60 Q61 T62 S63 A72 L73 R75 P77 V79 G82 G83 T84 H85 R86 Q89 N94 M95 C96 R97 S98 R100 M101 F102 A103 P104 K106 R109 K110 V113 K114 N116 Q117 N118 E119 K120 R121 R140 R143 K163 T164 K165 K188 L189 R190 A191 G192 K193 K195 R197 N198 R199 R204 R205 K219 R222 N223 R234 N236 G243 H245 K274 K275 I293 G306 P307 R309 K311 R312 H314 V315 Q316 K318 K322 N323 R329 A334 K335 Y337 A339 N340 K342 I343 N344 E346 K347 T348 P349 K350 A351 F356 L360 H361	R29 L32 R34 T38 K42 N43 K44 R45 Q46 Y48 V50 S51 E52 A54 H56 Q57 T58 S59 A68 L69 R71 P73 V75 G78 G79 T80 H81 R82 Q85 N90 M91 C92 R93 S94 R96 M97 F98 A99 P100 K102 R105 K106 V109 K110 N112 Q113 N114 E115 K116 R117 R136 R139 K159 T160 K161 K184 L185 R186 A187 G188 K189 K191 R193 N194 R195 R200 R201 K215 R218 N219 R230 N232 G239 H241 K270 K271 I289 G302 P303 R305 K307 R308 H310 V311 Q312 K314 K318 N319 R325 A330 K331 Y333 A335 N336 K338 I339 N340 E342 K343 T344 P345 K346 A347 F352 L356 H357
BS02	rna	C	P51 A53 S55 K195 L196	P47 A49 S51 K191 L192
BS03	peptide	C	K355 N363	K351 N359

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8etc, PDBe:8etc, PDBj:8etc
PDBsum	8etc
PubMed	36423630
UniProt	Q9P784\|RL4B_SCHPO Large ribosomal subunit protein uL4B (Gene Name=rpl401)

[Back to BioLiP]