Structure of PDB 8el5 Chain C

Receptor sequence

>8el5C (length=62) Species: 464988 (Hemiselmis andersenii) [Search protein sequence]

AMKKDSKAPCVEVFDERDGCKAAGTQKASGDDGFCVKVSMKAIKMNAAEA
TSVTKNYNTKLL

3D structure

PDB

8el5 Molecular dissection of the soluble photosynthetic antenna from the cryptophyte alga Hemiselmis andersenii

Chain

Resolution

1.67 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	PEB	C	K44 M45 A47	K44 M45 A47
BS02	PEB	C	F14 E16 C20 A22 T25 Q26 K27 A28 S29 G33 F34 C35 K37	F14 E16 C20 A22 T25 Q26 K27 A28 S29 G33 F34 C35 K37
BS03	AX9	C	K60 L61	K60 L61
BS04	PEB	C	M2 K4 S6	M2 K4 S6
BS05	PEB	C	V13 F14 R17 F34	V13 F14 R17 F34
BS06	PEB	C	R17 D31 D32	R17 D31 D32
BS07	PEB	C	K44 M45 A47	K44 M45 A47
BS08	PEB	C	F14 E16 C20 A22 T25 Q26 K27 A28 S29 G33 F34 C35 K37	F14 E16 C20 A22 T25 Q26 K27 A28 S29 G33 F34 C35 K37

Gene Ontology

	Cellular Component
GO:0030089	phycobilisome

External links

PDB	RCSB:8el5, PDBe:8el5, PDBj:8el5
PDBsum	8el5
PubMed	37957226
UniProt	U5TBJ3\|PHEA2_HEMAN Phycoerythrin alpha-2 subunit (Gene Name=HAND1043_LOCUS7931)