Structure of PDB 8dw6 Chain C

Receptor sequence

>8dw6C (length=432) Species: 2681598 (Escherichia phage T4)

MVEIILSHLIFDQAYFSKVWPYMDSEYFESGPAKNTFKLIKSHVNEYHSV
PSINALNVALENSSFTETEYSGVKTLISKLADSPEDHSWLVKETEKYVQQ
RAMFNATSKIIEIQTNAELPPEKRNKKMPDVGAIPDIMRQALSISFDSYV
GHDWMDDYEARWLSYMNKARKVPFKLRILNKITKGGAETGTLNVLMAGVN
VGKSLGLCSLAADYLQLGHNVLYISMEMAEEVCAKRIDANMLDVSLDDID
DGHISYAEYKGKMEKWREKSTLGRLIVKQYPTGGADANTFRSLLNELKLK
KNFVPTIIIVDYLGICKSCRIRVYSENSYTTVKAIAEELRALAVETETVL
WTAAQVGKQAWDSSDVNMSDIAESAGLPATADFMLAVIETEELAAAEQQL
IKQIKSRYGDKNKWNKFLMGVQKGNQKWVEIE

3D structure

• PDB: 8dw6 Structural basis of the T4 bacteriophage primosome assembly and primer synthesis.
• Chain: C
• Resolution: 3.5 Å

Enzymatic activity

• Enzyme Commision number: 3.6.4.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	C	Y329 K358 A372 E373 S374 A375	Y329 K358 A372 E373 S374 A375
BS02	AGS	C	V199 N200 V201 G202 K203 S204 L205 R236 K423	V199 N200 V201 G202 K203 S204 L205 R236 K423
BS03	MG	C	S204 E227	S204 E227
BS04	AGS	C	K405 R407 D410	K405 R407 D410

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003678 DNA helicase activity
• GO:0004386 helicase activity
• GO:0005524 ATP binding
• GO:0016787 hydrolase activity
• GO:0017116 single-stranded DNA helicase activity

Biological Process

• GO:0006260 DNA replication
• GO:0006268 DNA unwinding involved in DNA replication
• GO:0006269 DNA replication, synthesis of primer
• GO:0032508 DNA duplex unwinding
• GO:0039686 bidirectional double-stranded viral DNA replication
• GO:0039693 viral DNA genome replication

Cellular Component

• GO:0005829 cytosol
• GO:1990077 primosome complex

External links

• PDB: RCSB:8dw6, PDBe:8dw6, PDBj:8dw6
• PDBsum: 8dw6
• PubMed: 37474605
• UniProt: P04530|HELIC_BPT4 DnaB-like replicative helicase (Gene Name=41)