Structure of PDB 8cze Chain C |
>8czeC (length=109) Species: 8355 (Xenopus laevis) [Search protein sequence] |
TRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLP NIQSVLLPK |
|
PDB | 8cze Meiotic HORMAD proteins directly chromatin to regulate chromosome axis assembly and interhomolog crossover formation |
Chain | C |
Resolution | 2.58 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
C |
R17 R32 |
R8 R23 |
|
BS02 |
dna |
C |
R42 T76 |
R33 T67 |
|
|
|
|