Structure of PDB 8cef Chain C

Receptor sequence
>8cefC (length=85) Species: 10090 (Mus musculus) [Search protein sequence]
LPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNECEI
TKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGR
3D structure
PDB8cef Asymmetric dimerization in a transcription factor superfamily is promoted by allosteric interactions with DNA.
ChainC
Resolution2.486 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C Y89 H90 Y91 K100 K104 V149 R150 R153 R155 Y16 H17 Y18 K27 K31 V76 R77 R80 R82
BS02 dna C A98 F102 R105 R128 K129 Q132 R135 R155 G156 G157 A25 F29 R32 R55 K56 Q59 R62 R82 G83 G84
BS03 ZN C C79 C82 C99 C6 C9 C26
BS04 ZN C C115 C121 C131 C134 C42 C48 C58 C61
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8cef, PDBe:8cef, PDBj:8cef
PDBsum8cef
PubMed37503845
UniProtO08580|ERR1_MOUSE Steroid hormone receptor ERR1 (Gene Name=Esrra)

[Back to BioLiP]