Structure of PDB 8cbr Chain C

Receptor sequence

>8cbrC (length=50) Species: 11676 (Human immunodeficiency virus 1)

NFRVYYRDDPVWKGPAKLLEKGEGAVVIQDNSDIKVVPRRKAKIIRDYGK

3D structure

• PDB: 8cbr Biological and Structural Analyses of New Potent Allosteric Inhibitors of HIV-1 Integrase.
• Chain: C
• Resolution: 1.8 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.-
  2.7.7.49: RNA-directed DNA polymerase.
  2.7.7.7: DNA-directed DNA polymerase.
  3.1.-.-
  3.1.13.2: exoribonuclease H.
  3.1.26.13: retroviral ribonuclease H.
  3.4.23.16: HIV-1 retropepsin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	RWR	C	W235 K266	W12 K43

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding

Biological Process

• GO:0015074 DNA integration

External links

• PDB: RCSB:8cbr, PDBe:8cbr, PDBj:8cbr
• PDBsum: 8cbr
• PubMed: 37310224
• UniProt: P12497|POL_HV1N5 Gag-Pol polyprotein (Gene Name=gag-pol)