Structure of PDB 8byl Chain C

Receptor sequence
>8bylC (length=69) Species: 9606 (Homo sapiens) [Search protein sequence]
QIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGW
VHYMIHEPEPHILLFRRPL
3D structure
PDB8byl Cryo-EM structure of SKP1-SKP2-CKS1 in complex with CDK2-cyclin A-p27KIP1.
ChainC
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide C Y3008 R3020 R3044 Q3049 Q3050 S3051 Q3052 Y4 R16 R40 Q45 Q46 S47 Q48
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0016538 cyclin-dependent protein serine/threonine kinase regulator activity
GO:0019901 protein kinase binding
GO:0042393 histone binding
GO:0043130 ubiquitin binding
GO:0061575 cyclin-dependent protein serine/threonine kinase activator activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0007346 regulation of mitotic cell cycle
GO:0044772 mitotic cell cycle phase transition
GO:0048144 fibroblast proliferation
GO:0051301 cell division
Cellular Component
GO:0000307 cyclin-dependent protein kinase holoenzyme complex
GO:0005654 nucleoplasm
GO:0019005 SCF ubiquitin ligase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8byl, PDBe:8byl, PDBj:8byl
PDBsum8byl
PubMed37400515
UniProtP61024|CKS1_HUMAN Cyclin-dependent kinases regulatory subunit 1 (Gene Name=CKS1B)

[Back to BioLiP]