Structure of PDB 8bw9 Chain C

Receptor sequence
>8bw9C (length=280) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
ELSDEDLEKLGELGSGNGGVVMKVRHTHTHLIMARKLIHLEVKPAIKKQI
LRELKVLHECNFPHIVGFYGAFYSDGEISICMEYMDGGSLDLILKRAGRI
PESILGRITLAVLKGLSYLRDNHAIIHRDVKPSNILVNSSGEIKICDFGV
SGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMY
PIPPPAMAIFELLDYIVNEPPPKLEHKIFSTEFKDFVDICLKKQPDERAD
LKTLLSHPWIRKAELEEVDISGWVCKTMDL
3D structure
PDB8bw9 The CNK-HYP scaffolding complex promotes RAF activation by enhancing KSR-MEK interaction
ChainC
Resolution3.32 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.12.2: mitogen-activated protein kinase kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ANP C G99 V101 K116 M162 M165 S213 G19 V21 K36 M82 M85 S133
BS02 QOM C L137 D209 D227 G229 V230 S231 L234 I235 L57 D129 D147 G149 V150 S151 L154 I155
BS03 MG C K116 D227 K36 D147
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0004708 MAP kinase kinase activity
GO:0004712 protein serine/threonine/tyrosine kinase activity
GO:0004713 protein tyrosine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0019900 kinase binding
GO:0106310 protein serine kinase activity
Biological Process
GO:0000165 MAPK cascade
GO:0006468 protein phosphorylation
GO:0007095 mitotic G2 DNA damage checkpoint signaling
GO:0007173 epidermal growth factor receptor signaling pathway
GO:0007298 border follicle cell migration
GO:0007362 terminal region determination
GO:0007430 terminal branching, open tracheal system
GO:0007465 R7 cell fate commitment
GO:0008286 insulin receptor signaling pathway
GO:0008293 torso signaling pathway
GO:0008340 determination of adult lifespan
GO:0008543 fibroblast growth factor receptor signaling pathway
GO:0009953 dorsal/ventral pattern formation
GO:0016310 phosphorylation
GO:0033314 mitotic DNA replication checkpoint signaling
GO:0042386 hemocyte differentiation
GO:0042461 photoreceptor cell development
GO:0045500 sevenless signaling pathway
GO:0048010 vascular endothelial growth factor receptor signaling pathway
GO:0051607 defense response to virus
GO:0070371 ERK1 and ERK2 cascade
GO:0071481 cellular response to X-ray
Cellular Component
GO:0000793 condensed chromosome
GO:0005635 nuclear envelope
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bw9, PDBe:8bw9, PDBj:8bw9
PDBsum8bw9
PubMed38388830
UniProtQ24324|DSOR1_DROME Dual specificity mitogen-activated protein kinase kinase dSOR1 (Gene Name=Dsor1)

[Back to BioLiP]