Structure of PDB 8buv Chain C |
>8buvC (length=55) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
NFRVYYRDSRDPVWKGPAKLLEKGEGAVVIQDNSDIKVVPRRKAKIIRDY GKQMA |
|
PDB | 8buv HIV-1 Integrase Catalytic Core Domain and C-Terminal Domain in Complex with Allosteric Integrase Inhibitor LEDGIN 3 |
Chain | C |
Resolution | 2.04 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
723 |
C |
Y226 W235 |
Y5 W14 |
|
|
|
|