Structure of PDB 8br1 Chain C

Receptor sequence
>8br1C (length=365) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
ETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVQKDSYVGD
EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLT
EAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSG
DGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAER
EIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFR
CPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVMSGGTTMY
PGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMW
ITKQEYDEAGPSIVH
3D structure
PDB8br1 Functional and structural insights into the multi-step activation and catalytic mechanism of bacterial ExoY nucleotidyl cyclase toxins bound to actin-profilin.
ChainC
Resolution2.044 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.4.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP C G13 S14 G15 K18 G156 D157 V159 G182 R210 K213 E214 G302 M305 Y306 G10 S11 G12 K15 G150 D151 V153 G176 R204 K207 E208 G296 M299 Y300
BS02 LAB C G15 P32 Q59 Y69 D157 R183 T186 R206 E207 R210 G12 P29 Q53 Y63 D151 R177 T180 R200 E201 R204
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003785 actin monomer binding
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0005523 tropomyosin binding
GO:0005524 ATP binding
GO:0016787 hydrolase activity
GO:0019904 protein domain specific binding
GO:0031013 troponin I binding
GO:0031432 titin binding
GO:0032036 myosin heavy chain binding
GO:0042802 identical protein binding
GO:0048306 calcium-dependent protein binding
GO:0140660 cytoskeletal motor activator activity
Biological Process
GO:0010628 positive regulation of gene expression
GO:0030041 actin filament polymerization
GO:0030240 skeletal muscle thin filament assembly
GO:0048741 skeletal muscle fiber development
GO:0051017 actin filament bundle assembly
GO:0090131 mesenchyme migration
Cellular Component
GO:0001725 stress fiber
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005865 striated muscle thin filament
GO:0005884 actin filament
GO:0030027 lamellipodium
GO:0030175 filopodium
GO:0031941 filamentous actin
GO:0032432 actin filament bundle
GO:0044297 cell body
GO:0098723 skeletal muscle myofibril

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8br1, PDBe:8br1, PDBj:8br1
PDBsum8br1
PubMed37747912
UniProtP68135|ACTS_RABIT Actin, alpha skeletal muscle (Gene Name=ACTA1)

[Back to BioLiP]