Structure of PDB 8ayo Chain C

Receptor sequence
>8ayoC (length=399) Species: 10116 (Rattus norvegicus) [Search protein sequence]
RTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRL
EIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFS
KPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFL
VSRFSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIII
SSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSK
IAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIE
QRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLK
SKWWYDKGECGSKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSR
3D structure
PDB8ayo Modulatory mechanisms of TARP gamma 8-selective AMPA receptor therapeutics.
ChainC
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GLU C Y446 P474 T476 R481 G649 S650 T651 E701 Y58 P86 T88 R93 G240 S241 T242 E292
BS02 CYZ C P490 M492 S493 L747 S750 L755 D756 P102 M104 S105 L338 S341 L346 D347
BS03 OIJ C Y519 E520 M523 F527 Y131 E132 M135 F139
Gene Ontology
Molecular Function
GO:0001540 amyloid-beta binding
GO:0001965 G-protein alpha-subunit binding
GO:0004970 glutamate-gated receptor activity
GO:0004971 AMPA glutamate receptor activity
GO:0005216 monoatomic ion channel activity
GO:0005515 protein binding
GO:0008179 adenylate cyclase binding
GO:0015276 ligand-gated monoatomic ion channel activity
GO:0019865 immunoglobulin binding
GO:0019901 protein kinase binding
GO:0019904 protein domain specific binding
GO:0022849 glutamate-gated calcium ion channel activity
GO:0030165 PDZ domain binding
GO:0031267 small GTPase binding
GO:0031489 myosin V binding
GO:0031681 G-protein beta-subunit binding
GO:0031698 beta-2 adrenergic receptor binding
GO:0035254 glutamate receptor binding
GO:0038023 signaling receptor activity
GO:0042802 identical protein binding
GO:0051018 protein kinase A binding
GO:0051428 peptide hormone receptor binding
GO:0097110 scaffold protein binding
GO:0099507 ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential
GO:0099583 neurotransmitter receptor activity involved in regulation of postsynaptic cytosolic calcium ion concentration
GO:1904315 transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
Biological Process
GO:0001919 regulation of receptor recycling
GO:0006811 monoatomic ion transport
GO:0007268 chemical synaptic transmission
GO:0007416 synapse assembly
GO:0007616 long-term memory
GO:0009410 response to xenobiotic stimulus
GO:0009636 response to toxic substance
GO:0009744 response to sucrose
GO:0010226 response to lithium ion
GO:0010628 positive regulation of gene expression
GO:0014070 response to organic cyclic compound
GO:0019228 neuronal action potential
GO:0019722 calcium-mediated signaling
GO:0021510 spinal cord development
GO:0021987 cerebral cortex development
GO:0031623 receptor internalization
GO:0031667 response to nutrient levels
GO:0032355 response to estradiol
GO:0034220 monoatomic ion transmembrane transport
GO:0034765 regulation of monoatomic ion transmembrane transport
GO:0035235 ionotropic glutamate receptor signaling pathway
GO:0035249 synaptic transmission, glutamatergic
GO:0042220 response to cocaine
GO:0043278 response to morphine
GO:0043434 response to peptide hormone
GO:0045471 response to ethanol
GO:0045838 positive regulation of membrane potential
GO:0046685 response to arsenic-containing substance
GO:0048167 regulation of synaptic plasticity
GO:0048266 behavioral response to pain
GO:0050804 modulation of chemical synaptic transmission
GO:0050806 positive regulation of synaptic transmission
GO:0051602 response to electrical stimulus
GO:0060078 regulation of postsynaptic membrane potential
GO:0060291 long-term synaptic potentiation
GO:0060292 long-term synaptic depression
GO:0060992 response to fungicide
GO:0071230 cellular response to amino acid stimulus
GO:0071242 cellular response to ammonium ion
GO:0071359 cellular response to dsRNA
GO:0071363 cellular response to growth factor stimulus
GO:0071375 cellular response to peptide hormone stimulus
GO:0071407 cellular response to organic cyclic compound
GO:0071418 cellular response to amine stimulus
GO:0090326 positive regulation of locomotion involved in locomotory behavior
GO:0099505 regulation of presynaptic membrane potential
GO:0099566 regulation of postsynaptic cytosolic calcium ion concentration
GO:1905232 cellular response to L-glutamate
GO:1990416 cellular response to brain-derived neurotrophic factor stimulus
GO:1990708 conditioned place preference
GO:1990911 response to psychosocial stress
GO:2000463 positive regulation of excitatory postsynaptic potential
Cellular Component
GO:0005768 endosome
GO:0005769 early endosome
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005911 cell-cell junction
GO:0008021 synaptic vesicle
GO:0008328 ionotropic glutamate receptor complex
GO:0009897 external side of plasma membrane
GO:0009986 cell surface
GO:0014069 postsynaptic density
GO:0016020 membrane
GO:0030425 dendrite
GO:0030672 synaptic vesicle membrane
GO:0031594 neuromuscular junction
GO:0031901 early endosome membrane
GO:0032279 asymmetric synapse
GO:0032281 AMPA glutamate receptor complex
GO:0032590 dendrite membrane
GO:0032591 dendritic spine membrane
GO:0032809 neuronal cell body membrane
GO:0032991 protein-containing complex
GO:0036477 somatodendritic compartment
GO:0042734 presynaptic membrane
GO:0042995 cell projection
GO:0043005 neuron projection
GO:0043025 neuronal cell body
GO:0043197 dendritic spine
GO:0043198 dendritic shaft
GO:0044297 cell body
GO:0044308 axonal spine
GO:0044309 neuron spine
GO:0045202 synapse
GO:0045211 postsynaptic membrane
GO:0048787 presynaptic active zone membrane
GO:0055037 recycling endosome
GO:0055038 recycling endosome membrane
GO:0060076 excitatory synapse
GO:0097060 synaptic membrane
GO:0098793 presynapse
GO:0098794 postsynapse
GO:0098839 postsynaptic density membrane
GO:0098978 glutamatergic synapse
GO:0099092 postsynaptic density, intracellular component
GO:0099544 perisynaptic space
GO:1990635 proximal dendrite

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ayo, PDBe:8ayo, PDBj:8ayo
PDBsum8ayo
PubMed36966141
UniProtP19490|GRIA1_RAT Glutamate receptor 1 (Gene Name=Gria1)

[Back to BioLiP]