Structure of PDB 8agc Chain C |
>8agcC (length=85) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] |
TYEQLYKEFHSSKSFQPFIHLDTQPKFAICGLIVTLAVLSSALFAVGSKS SYIKKLFFYTILSVIGSLFAGLTTVFASNSFGVYV |
|
PDB | 8agc Molecular basis for glycan recognition and reaction priming of eukaryotic oligosaccharyltransferase. |
Chain | C |
Resolution | 3.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CPL |
C |
F82 Y85 |
F81 Y84 |
|
|
|
|